1.67 Rating by CuteStat

bryanwilksharvardmasterdegree.com is 7 years 3 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, bryanwilksharvardmasterdegree.com is SAFE to browse.

PageSpeed Score
81
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

37.60.244.250

Hosted Country:

United States of America US

Location Latitude:

41.8797

Location Longitude:

-87.6435
SiteGround System Page Coming Soon

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: 4
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 37.60.244.250)

Steve Sasco designer of jewelry inspired by celebrities

- stevesascodesigns.com

Steve Sasco – Celebrity Jewelry Designer – Limited Editions. Unique jewelry items inspired by the celebrities who wear them!

Not Applicable $ 8.95

My Blog - My WordPress Blog

- beantoseattle.com
Not Applicable $ 8.95

EDssentials | Inspiration is Essential for EDucation

- edssentials.com
Not Applicable $ 8.95

SiteGround System Page Coming Soon

- ajmlandscaping.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Date: Wed, 25 Jan 2017 00:51:01 GMT
Content-Type: text/html
Content-Length: 3212
Connection: keep-alive
Last-Modified: Thu, 01 Aug 2013 06:54:44 GMT
ETag: "c8c-4e2dd5126f500"
Host-Header: 192fc2e7e50945beb8231a492d6a8024
X-Proxy-Cache: MISS
Accept-Ranges: bytes

Domain Information

Domain Registrar: Tucows Domains Inc
Registration Date: Jan 24, 2017, 12:00 AM 7 years 3 months 5 days ago
Last Modified: Jan 24, 2017, 12:00 AM 7 years 3 months 5 days ago
Expiration Date: Jan 24, 2018, 12:00 AM 6 years 3 months 4 days ago
Domain Status:
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1.us63.siteground.us 75.2.77.104 United States of America United States of America
ns2.us63.siteground.us 99.83.229.113 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
bryanwilksharvardmasterdegree.com A 14396 IP: 37.60.244.250
bryanwilksharvardmasterdegree.com NS 86399 Target: ns2.us63.siteground.us
bryanwilksharvardmasterdegree.com NS 86399 Target: ns1.us63.siteground.us
bryanwilksharvardmasterdegree.com SOA 86399 MNAME: ns1.us63.siteground.us
RNAME: root.us63.siteground.us
Serial: 2017012401
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
bryanwilksharvardmasterdegree.com MX 14399 Target: bryanwilksharvardmasterdegree.com

Full WHOIS Lookup

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: BRYANWILKSHARVARDMASTERDEGREE.COM
Registrar: TUCOWS DOMAINS INC.
Sponsoring Registrar IANA ID: 69
Whois Server: whois.tucows.com
Referral URL: http://www.tucowsdomains.com
Name Server: NS1.US63.SITEGROUND.US
Name Server: NS2.US63.SITEGROUND.US
Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Updated Date: 24-jan-2017
Creation Date: 24-jan-2017
Expiration Date: 24-jan-2018

>>> Last update of whois database: Wed, 25 Jan 2017 00:50:54 GMT